PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g55797.2.p
Common NameBRADI_2g55797, LOC100835709
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 184aa    MW: 20686.8 Da    PI: 7.6352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g55797.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81.1e-072367345
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      +W++ Ed+ + +a  + + +   +W+++a++++ gR++ +  +++q
  Bradi2g55797.2.p 23 PWSKAEDKAFENALVLCPEHapgRWERVAAHVP-GRSPREAWEHYQ 67
                      8*****************99*************.***988777776 PP

2Myb_DNA-binding47.25e-15116160347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eE++l++d+ +++G g+W+ I+r    +Rt+ q+ s+ qky
  Bradi2g55797.2.p 116 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRTRTPTQVASHAQKY 160
                       7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-112069IPR009057Homeodomain-like
SMARTSM007170.0022072IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-62270IPR009057Homeodomain-like
CDDcd001676.62E-62361No hitNo description
PROSITE profilePS500906.6672370IPR017877Myb-like domain
PfamPF002491.9E-62366IPR001005SANT/Myb domain
PROSITE profilePS5129418.225109165IPR017930Myb domain
SuperFamilySSF466892.94E-17111166IPR009057Homeodomain-like
SMARTSM007175.6E-11113163IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.8E-16114164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-11116159IPR009057Homeodomain-like
CDDcd001676.20E-11116161No hitNo description
PfamPF002491.3E-12116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MDSSYYCSNY QAAAAAAAPW SRPWSKAEDK AFENALVLCP EHAPGRWERV AAHVPGRSPR  60
EAWEHYQALV ADVDLIERGA VDVPACWNHD EDGDDDGTAA RRAGKARGEE RRRGIPWSEE  120
EHKLFLDGLE KYGRGDWRNI SRFAVRTRTP TQVASHAQKY FIRQANAATR DSKRKSIHDI  180
TTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1322102986RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0968781e-157FP096878.1 Phyllostachys edulis cDNA clone: bphyem104c18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567296.11e-133PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-53DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0Q3IYG41e-133A0A0Q3IYG4_BRADI; Uncharacterized protein
STRINGBRADI2G55797.11e-103(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-46MYB family protein